Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sigirr protein

This Mouse Sigirr protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name, TIR8

UniProt

Q9JLZ8

Expression Region

1-117aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Osteocrin (OSTN) ELISA Kit
BSKH63996-01 48 Tests

Human Osteocrin (OSTN) ELISA Kit

Sign In for Pricing
View Details
Human Osteocrin (OSTN) ELISA Kit
BSKH63996-02 96 Tests

Human Osteocrin (OSTN) ELISA Kit

Sign In for Pricing
View Details
HADHB protein (His tag)
80R-4075 100 ug

HADHB protein (His tag)

Sign In for Pricing
View Details
ALKBH7 Human Gene Knockout Kit (CRISPR)
KN402583 1 Kit

ALKBH7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNC1 Antibody (C-term) Blocking Peptide
MBS9220879-01 0.5 mg

KCNC1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
KCNC1 Antibody (C-term) Blocking Peptide
MBS9220879-02 5x 0.5 mg

KCNC1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details