Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sigirr protein

This Mouse Sigirr protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name, TIR8

UniProt

Q9JLZ8

Expression Region

1-117aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Staphylococcus aureus, Enterotoxin G (Enterotoxin Type G, SEG, entG) (AP) discontinued
S7965-24H2-AP 100 µL

Staphylococcus aureus, Enterotoxin G (Enterotoxin Type G, SEG, entG) (AP) discontinued

Sign In for Pricing
View Details
Iduronate 2 sulfatase Rabbit Polyclonal Antibody (AP)
orb929282 100 µL

Iduronate 2 sulfatase Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
TRIM50 (NM_178125) Human Over-expression Lysate
LS135892-20ug 20 µg

TRIM50 (NM_178125) Human Over-expression Lysate

Sign In for Pricing
View Details
COLQ Rabbit pAb, PE-Cy5.5 conjugated
orb2861715 100 µL

COLQ Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
MOrange Escherichia coli Recombinant Protein
E45O49249E1 250 µg

MOrange Escherichia coli Recombinant Protein

Sign In for Pricing
View Details
Zalutumumab
T76721-01 1 mg

Zalutumumab

Sign In for Pricing
View Details