Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Isoallergen 1 protein

This Plant Isoallergen 1 protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Api g 1.0101 Allergen Api g I Allergen, Api g 1

UniProt

P49372

Expression Region

1-154aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Apium graveolens (Celery)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASS1 Human Gene Knockout Kit (CRISPR)
KN201130LP 1 Kit

ASS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Fgf8 activation kit by CRISPRa
GA201406 1 Kit

Mouse Fgf8 activation kit by CRISPRa

Sign In for Pricing
View Details
ADSS1 Antibody
KC-34403-01 50 μL

ADSS1 Antibody

Sign In for Pricing
View Details
ADSS1 Antibody
KC-34403-02 100 µL

ADSS1 Antibody

Sign In for Pricing
View Details
ADSS1 Antibody
KC-34403-03 1 mL

ADSS1 Antibody

Sign In for Pricing
View Details
NFATC4 (NM_001136022) Human Over-expression Lysate
LY427771 100 µg

NFATC4 (NM_001136022) Human Over-expression Lysate

Sign In for Pricing
View Details