Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral IX protein

This Viral IX protein spans the amino acid sequence from region 1-32aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coat protein C, polypeptide II G9P

UniProt

P69538

Expression Region

1-32aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage M13 (Bacteriophage M13)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSVLVYSFASFVLGWCLRSGITYFTRLMETSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TFPI2 sgRNA gene knockout kit - Lentiviral human TFPI2 sgRNA gene knockout kit (100)
GTR15354846 1 Vial

Lentiviral human TFPI2 sgRNA gene knockout kit - Lentiviral human TFPI2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Lentiviral human NOTCH3 shRNA (UAS) - Lentiviral human NOTCH3 shRNA (UAS, GFP) plasmid
GTR15143146 1 Vial

Lentiviral human NOTCH3 shRNA (UAS) - Lentiviral human NOTCH3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant BAG2 Monoclonal Antibody
AN301757L-01 50 µL

Recombinant BAG2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant BAG2 Monoclonal Antibody
AN301757L-02 100 µL

Recombinant BAG2 Monoclonal Antibody

Sign In for Pricing
View Details
ZNF575 (Zinc Finger Protein 575)
496640 100 µL

ZNF575 (Zinc Finger Protein 575)

Sign In for Pricing
View Details
LentimiRa-rno-miR-423-3p Vector
mr40823 500 ng

LentimiRa-rno-miR-423-3p Vector

Sign In for Pricing
View Details