Viral IX protein
This Viral IX protein spans the amino acid sequence from region 1-32aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Coat protein C, polypeptide II G9P
UniProt
P69538
Expression Region
1-32aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Enterobacteria phage M13 (Bacteriophage M13)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
19.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1351885-01 0.02 mg (E-Coli)
Recombinant Bovine Follistatin-related protein 3 (FSTL3)
Sign In for Pricing
View Details MBS1351885-02 0.1 mg (E-Coli)
Recombinant Bovine Follistatin-related protein 3 (FSTL3)
Sign In for Pricing
View Details MBS1351885-03 0.02 mg (Yeast)
Recombinant Bovine Follistatin-related protein 3 (FSTL3)
Sign In for Pricing
View Details MBS1351885-04 0.1 mg (Yeast)
Recombinant Bovine Follistatin-related protein 3 (FSTL3)
Sign In for Pricing
View Details MBS1351885-05 0.02 mg (Baculovirus)
Recombinant Bovine Follistatin-related protein 3 (FSTL3)
Sign In for Pricing
View Details MBS1351885-06 0.02 mg (Mammalian-Cell)
Recombinant Bovine Follistatin-related protein 3 (FSTL3)
Sign In for Pricing
View Details