Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pig AVPR2 protein

This Pig AVPR2 protein spans the amino acid sequence from region 292-370aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

V2R Alternative name (s), AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor

UniProt

P32307

Expression Region

292-370aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cross-linked Carboxy-terminal telopeptide of type I collagen, I CTP ELISA Kit
NB-E20028 96 Well

Mouse Cross-linked Carboxy-terminal telopeptide of type I collagen, I CTP ELISA Kit

Sign In for Pricing
View Details
Anti-Squalene Epoxidase Antibody
MBS8291955-01 0.03 mL

Anti-Squalene Epoxidase Antibody

Sign In for Pricing
View Details
Anti-Squalene Epoxidase Antibody
MBS8291955-02 0.05 mL

Anti-Squalene Epoxidase Antibody

Sign In for Pricing
View Details
Anti-Squalene Epoxidase Antibody
MBS8291955-03 0.1 mL

Anti-Squalene Epoxidase Antibody

Sign In for Pricing
View Details
Anti-Squalene Epoxidase Antibody
MBS8291955-04 0.2 mL

Anti-Squalene Epoxidase Antibody

Sign In for Pricing
View Details
Anti-Squalene Epoxidase Antibody
MBS8291955-05 5x 0.2 mL

Anti-Squalene Epoxidase Antibody

Sign In for Pricing
View Details