Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RUVBL2 protein

This Human RUVBL2 protein spans the amino acid sequence from region 2-463aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

48KDA TATA box-binding protein-interacting protein Short name, 48KDA TBP-interacting protein 51KDA erythrocyte cytosolic protein Short name, ECP-51 INO80 complex subunit J Repressing pontin 52 Short name, Reptin 52 TIP49b TIP60-associated protein 54-beta Short name, TAP54-beta

UniProt

Q9Y230

Expression Region

2-463aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCERG1 Protein Vector (Rat) (pPB-C-His)
PV310118 500 ng

TCERG1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
RGS17 Antibody
orb1313581-01 30 µL

RGS17 Antibody

Sign In for Pricing
View Details
RGS17 Antibody
orb1313581-02 50 μL

RGS17 Antibody

Sign In for Pricing
View Details
RGS17 Antibody
orb1313581-03 100 µL

RGS17 Antibody

Sign In for Pricing
View Details
PCMV-C4BPA (1-539aa) -FLAG-Neo Plasmid
PVT74244 2 µg

PCMV-C4BPA (1-539aa) -FLAG-Neo Plasmid

Sign In for Pricing
View Details
Recombinant Rat Angiopoietin-1/ANG1 protein (His tag)
MBS2571205-01 0.02 mg

Recombinant Rat Angiopoietin-1/ANG1 protein (His tag)

Sign In for Pricing
View Details