What is the catalog number for Viral T4 Lysozyme protein?

The catalog number for Viral T4 Lysozyme protein is orb383100.

What sizes are available for Viral T4 Lysozyme protein?

Viral T4 Lysozyme protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Viral T4 Lysozyme protein come in?

Viral T4 Lysozyme protein is available in 3 different pack sizes.

Is Viral T4 Lysozyme protein in stock?

Viral T4 Lysozyme protein is currently made to order / not held in immediate stock. Contact us for lead time.

Viral T4 Lysozyme protein

This Viral T4 Lysozyme protein spans the amino acid sequence from region 1-164aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lysis protein Lysozyme Muramidase

UniProt

P00720

Expression Region

1-164aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL