Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD1C protein

This Human CD1C protein spans the amino acid sequence from region 18-302aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BDCA1, CD1, CD1A, CD1c, CD1c antigen, CD1C antigen c polypeptide, CD1c molecule, CD1C_HUMAN, Cortical thymocyte antigen CD1C, Differentiation antigen CD1 alpha 3, R7, T cell surface glycoprotein CD1c, T-cell surface glycoprotein CD1c

UniProt

P29017

Expression Region

18-302aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calligonine
orb2815753-01 10 mg

Calligonine

Sign In for Pricing
View Details
Calligonine
orb2815753-02 50 mg

Calligonine

Sign In for Pricing
View Details
Pulverulentoside I
T126138-01 1 mg

Pulverulentoside I

Sign In for Pricing
View Details
Pulverulentoside I
T126138-02 5 mg

Pulverulentoside I

Sign In for Pricing
View Details
RIT2 (Ras-like Protein Expressed in Neurons, Ras-like Without CAAX Protein 2, RIN, ROC2)
MBS631823-01 0.1 mg

RIT2 (Ras-like Protein Expressed in Neurons, Ras-like Without CAAX Protein 2, RIN, ROC2)

Sign In for Pricing
View Details
RIT2 (Ras-like Protein Expressed in Neurons, Ras-like Without CAAX Protein 2, RIN, ROC2)
MBS631823-02 5x 0.1 mg

RIT2 (Ras-like Protein Expressed in Neurons, Ras-like Without CAAX Protein 2, RIN, ROC2)

Sign In for Pricing
View Details