Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD1C protein

This Human CD1C protein spans the amino acid sequence from region 18-302aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BDCA1, CD1, CD1A, CD1c, CD1c antigen, CD1C antigen c polypeptide, CD1c molecule, CD1C_HUMAN, Cortical thymocyte antigen CD1C, Differentiation antigen CD1 alpha 3, R7, T cell surface glycoprotein CD1c, T-cell surface glycoprotein CD1c

UniProt

P29017

Expression Region

18-302aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snx20 3'UTR GFP Stable Cell Line
TU270936 1.0 mL

Snx20 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Trp63 Protein Vector (Mouse) (pPB-N-His)
PV241959 500 ng

Trp63 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-CD74 Antibody Fluoro488 Conjugated
A01340-2-Fluoro488 100 µg/Vial

Anti-CD74 Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
TLX3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2402205 100 µL

TLX3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Chicken ATP-binding cassette sub-family A member 7 (ABCA7) ELISA Kit
MBS7227879-01 48 Well

Chicken ATP-binding cassette sub-family A member 7 (ABCA7) ELISA Kit

Sign In for Pricing
View Details
Chicken ATP-binding cassette sub-family A member 7 (ABCA7) ELISA Kit
MBS7227879-02 96 Well

Chicken ATP-binding cassette sub-family A member 7 (ABCA7) ELISA Kit

Sign In for Pricing
View Details