Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Transthyretin protein

This Mouse Transthyretin protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anti Amyloidosis Iprotein, anti ATTRprotein, anti CTSprotein, anti CTS1protein, anti HEL111protein, anti HsT2651protein, anti PALBprotein, anti Prealbumin amyloidosis type Iprotein, anti TBPAprotein, anti Transthyretinprotein, anti TTRprotein, anti TTR proteinprotein

UniProt

P07309

Expression Region

21-147aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRCT1 (NM_001039792) Human Over-expression Lysate
LY421830 100 µg

HRCT1 (NM_001039792) Human Over-expression Lysate

Sign In for Pricing
View Details
Human HS3ST6 activation kit by CRISPRa
GA112109 1 Kit

Human HS3ST6 activation kit by CRISPRa

Sign In for Pricing
View Details
M Cadherin (CDH15) Rabbit Polyclonal Antibody
AP06795PU-N 100 µg

M Cadherin (CDH15) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LSM11 Mouse Monoclonal Antibody [Clone ID: OTI7F12]
CF810042 100 µg

LSM11 Mouse Monoclonal Antibody [Clone ID: OTI7F12]

Sign In for Pricing
View Details
Phosphatidic acid phosphatase type 2B (PLPP3) Rabbit Polyclonal Antibody
AP05176PU-N 100 µg

Phosphatidic acid phosphatase type 2B (PLPP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDE1B Recombinant Rabbit monoclonal Antibody
HA723934 100 µL

PDE1B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details