Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Transthyretin protein

This Mouse Transthyretin protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anti Amyloidosis Iprotein, anti ATTRprotein, anti CTSprotein, anti CTS1protein, anti HEL111protein, anti HsT2651protein, anti PALBprotein, anti Prealbumin amyloidosis type Iprotein, anti TBPAprotein, anti Transthyretinprotein, anti TTRprotein, anti TTR proteinprotein

UniProt

P07309

Expression Region

21-147aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PADI4 Conjugated Antibody
C32493 100 µL

PADI4 Conjugated Antibody

Sign In for Pricing
View Details
GLUT8 (SLC2A8) (NM_014580) Human Tagged ORF Clone Lentiviral Particle
RC204317L1V 200 µL

GLUT8 (SLC2A8) (NM_014580) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Phospho-Jun B (S259) antibody
STJ90318 200 µl

Anti-Phospho-Jun B (S259) antibody

Sign In for Pricing
View Details
Anti-GM2/GD2 synthase antibody
STJ93301 200 µl

Anti-GM2/GD2 synthase antibody

Sign In for Pricing
View Details
REMBRANDT® PLAG1 break apart FISH detection assay
C823K.2030.10 10 Assays

REMBRANDT® PLAG1 break apart FISH detection assay

Sign In for Pricing
View Details
CA5B ELISA Kit (Human) (OKCD08378)
OKCD08378 96 Well

CA5B ELISA Kit (Human) (OKCD08378)

Sign In for Pricing
View Details