Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sigirr protein

This Mouse Sigirr protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name, TIR8

UniProt

Q9JLZ8

Expression Region

1-117aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- ((5-Acetyl-4,5,6,7-tetrahydrothieno[3,2-c]pyridin-2-yl) oxy) -1-cyclopropyl-2- (2-fluorophenyl) ethanone
412907 5 mg

2- ((5-Acetyl-4,5,6,7-tetrahydrothieno[3,2-c]pyridin-2-yl) oxy) -1-cyclopropyl-2- (2-fluorophenyl) ethanone

Sign In for Pricing
View Details
UBA1 (NM_003334) Human Over-expression Lysate
LS007317-20ug 20 µg

UBA1 (NM_003334) Human Over-expression Lysate

Sign In for Pricing
View Details
LOC690806 Recombinant Protein (Rat)
RP209681 100 µg

LOC690806 Recombinant Protein (Rat)

Sign In for Pricing
View Details
APLNR Rabbit Polyclonal Antibody (Biotin)
orb2097931 100 µL

APLNR Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Withaphysalin E
orb1681408 5 mg

Withaphysalin E

Sign In for Pricing
View Details
SLC44A1 Polyclonal Antibody
orb1417548 100 µL

SLC44A1 Polyclonal Antibody

Sign In for Pricing
View Details