Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MORC3 protein

This Human MORC3 protein spans the amino acid sequence from region 1-290aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear matrix protein 21 Zinc finger CW-type coiled-coil domain protein 3

UniProt

Q14149

Expression Region

1-290aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A10 Protein Lysate (Human) with C-Ha Tag
43978031 100 µg

SLC25A10 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Recombinant Buthus occitanus tunetanus Beta-insect depressant toxin BotIT6
MBS1245193-01 0.02 mg (E-Coli)

Recombinant Buthus occitanus tunetanus Beta-insect depressant toxin BotIT6

Sign In for Pricing
View Details
Recombinant Buthus occitanus tunetanus Beta-insect depressant toxin BotIT6
MBS1245193-02 0.1 mg (E-Coli)

Recombinant Buthus occitanus tunetanus Beta-insect depressant toxin BotIT6

Sign In for Pricing
View Details
Recombinant Buthus occitanus tunetanus Beta-insect depressant toxin BotIT6
MBS1245193-03 0.02 mg (Yeast)

Recombinant Buthus occitanus tunetanus Beta-insect depressant toxin BotIT6

Sign In for Pricing
View Details
Recombinant Buthus occitanus tunetanus Beta-insect depressant toxin BotIT6
MBS1245193-04 0.1 mg (Yeast)

Recombinant Buthus occitanus tunetanus Beta-insect depressant toxin BotIT6

Sign In for Pricing
View Details
Recombinant Buthus occitanus tunetanus Beta-insect depressant toxin BotIT6
MBS1245193-05 0.02 mg (Baculovirus)

Recombinant Buthus occitanus tunetanus Beta-insect depressant toxin BotIT6

Sign In for Pricing
View Details