Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Dpp4 protein

This Rat Dpp4 protein spans the amino acid sequence from region 638-767aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bile canaliculus domain-specific membrane glycoprotein Dipeptidyl peptidase IV Short name, DPP IV GP110 glycoprotein T-cell activation antigen CD26 CD_antigen, CD26 Cleaved into the following 3 chains, Dipeptidyl peptidase 4 membrane form Alternative name (s), Dipeptidyl peptidase IV membrane form Dipeptidyl peptidase 4 soluble form Alternative name (s), Dipeptidyl peptidase IV soluble form Dipeptidyl peptidase 4 60KDA soluble form Alternative name (s), Dipeptidyl peptidase IV 60KDA soluble form

UniProt

P14740

Expression Region

638-767aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pex5l (NM_173152) Rat Tagged ORF Clone Lentiviral Particle
RR213919L3V 200 µL

Pex5l (NM_173152) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
8-Benzyloxyadenosine
HY-152719 1 Each

8-Benzyloxyadenosine

Sign In for Pricing
View Details
IGF2BP2 Polyclonal Antibody
MBS2555302-01 0.06 mL

IGF2BP2 Polyclonal Antibody

Sign In for Pricing
View Details
IGF2BP2 Polyclonal Antibody
MBS2555302-02 0.12 mL

IGF2BP2 Polyclonal Antibody

Sign In for Pricing
View Details
IGF2BP2 Polyclonal Antibody
MBS2555302-03 0.2 mL

IGF2BP2 Polyclonal Antibody

Sign In for Pricing
View Details
IGF2BP2 Polyclonal Antibody
MBS2555302-04 5x 0.2 mL

IGF2BP2 Polyclonal Antibody

Sign In for Pricing
View Details