What is the catalog number for Hamster PRDX1 protein?

The catalog number for Hamster PRDX1 protein is orb383082.

What sizes are available for Hamster PRDX1 protein?

Hamster PRDX1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Hamster PRDX1 protein come in?

Hamster PRDX1 protein is available in 3 different pack sizes.

Is Hamster PRDX1 protein in stock?

Hamster PRDX1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Hamster PRDX1 protein

This Hamster PRDX1 protein spans the amino acid sequence from region 2-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thioredoxin peroxidase 2 Short name, TPX-2

UniProt

Q9JKY1

Expression Region

2-199aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK