Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast ponA protein

This Yeast ponA protein spans the amino acid sequence from region 23-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PonA, DDB_G0293522, Ponticulin

UniProt

P54660

Expression Region

23-118aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Secretogranin-1, CHGB ELISA KIT
E2443Mo-01 48 Well

Mouse Secretogranin-1, CHGB ELISA KIT

Sign In for Pricing
View Details
Mouse Secretogranin-1, CHGB ELISA KIT
E2443Mo-02 96 Well

Mouse Secretogranin-1, CHGB ELISA KIT

Sign In for Pricing
View Details
Mouse Secretogranin-1, CHGB ELISA KIT
E2443Mo-03 5x 96 Tests

Mouse Secretogranin-1, CHGB ELISA KIT

Sign In for Pricing
View Details
Mouse Secretogranin-1, CHGB ELISA KIT
E2443Mo-04 10x 96 Tests

Mouse Secretogranin-1, CHGB ELISA KIT

Sign In for Pricing
View Details
CD45R antibody
MBS531979-01 0.5 mg

CD45R antibody

Sign In for Pricing
View Details
CD45R antibody
MBS531979-02 5x 0.5 mg

CD45R antibody

Sign In for Pricing
View Details