What is the catalog number for Chicken RHOT1 protein?

The catalog number for Chicken RHOT1 protein is orb383070.

What sizes are available for Chicken RHOT1 protein?

Chicken RHOT1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Chicken RHOT1 protein come in?

Chicken RHOT1 protein is available in 3 different pack sizes.

Is Chicken RHOT1 protein in stock?

Chicken RHOT1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Chicken RHOT1 protein

This Chicken RHOT1 protein spans the amino acid sequence from region 1-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MIRO-1 Alternative name (s), Ras homolog gene family member T1

UniProt

Q5ZM73

Expression Region

1-219aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQNDEQLYHEISQANVICIVYAVNNKNSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNRSELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFRISDQDNDGTLNDAELNFFQRICFNT