Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Thy1 protein

This Mouse Thy1 protein spans the amino acid sequence from region 20-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thy-1 antigen CD_antigen, CD90

UniProt

P01831

Expression Region

20-131aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clic1 3'UTR Luciferase Stable Cell Line
TU104018 1.0 mL

Clic1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
St6galnac1 ORF Vector (Mouse) (pORF)
45641014 1.0 µg DNA

St6galnac1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
7-Propargylamino-7-deaza-dATP-ATTO-633
NU-1611-633 40 µL

7-Propargylamino-7-deaza-dATP-ATTO-633

Sign In for Pricing
View Details
KLHL2 Protein Vector (Human) (pPM-C-His)
PV022904 500 ng

KLHL2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Fmoc-N-Me-Asp (OtBu) -OH
217363-01 250 mg

Fmoc-N-Me-Asp (OtBu) -OH

Sign In for Pricing
View Details
Fmoc-N-Me-Asp (OtBu) -OH
217363-02 1 g

Fmoc-N-Me-Asp (OtBu) -OH

Sign In for Pricing
View Details