Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Thy1 protein

This Mouse Thy1 protein spans the amino acid sequence from region 20-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thy-1 antigen CD_antigen, CD90

UniProt

P01831

Expression Region

20-131aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ctse  ELISA Kit
EF018438 96 Tests

Rat Ctse ELISA Kit

Sign In for Pricing
View Details
Coro1b 3'UTR GFP Stable Cell Line
TU252681 1.0 mL

Coro1b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NUP98 Rabbit mAb
C05281-100uL*2 2x 100μL

NUP98 Rabbit mAb

Sign In for Pricing
View Details
ARFGAP1/2/3 (F-3)
sc-390955 200 µg/mL

ARFGAP1/2/3 (F-3)

Sign In for Pricing
View Details
1-Cyclopropyl-6-fluoro-8-methoxy-7- ((4-methoxybenzyl) amino) -4-oxo-1,4-dihydroquinoline-3-carboxylic Acid
409612-01 500 mg

1-Cyclopropyl-6-fluoro-8-methoxy-7- ((4-methoxybenzyl) amino) -4-oxo-1,4-dihydroquinoline-3-carboxylic Acid

Sign In for Pricing
View Details
1-Cyclopropyl-6-fluoro-8-methoxy-7- ((4-methoxybenzyl) amino) -4-oxo-1,4-dihydroquinoline-3-carboxylic Acid
409612-02 2.5 g

1-Cyclopropyl-6-fluoro-8-methoxy-7- ((4-methoxybenzyl) amino) -4-oxo-1,4-dihydroquinoline-3-carboxylic Acid

Sign In for Pricing
View Details