Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant PC237 protein

This Plant PC237 protein spans the amino acid sequence from region 1-39aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glutenin, high molecular weight subunit PC237, Fragment

UniProt

P02862

Expression Region

1-39aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Triticum aestivum (Wheat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal GST-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVSVEHQAARLKVAKAQQLAAQLPAMCRLEGGDALSASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (3-chloro-5- (trifluoromethyl) (2-pyridylthio) ) -N- (((phenylamino) thioxomethyl) amino) ethanamide
XQB60030 250 mg

2- (3-chloro-5- (trifluoromethyl) (2-pyridylthio) ) -N- (((phenylamino) thioxomethyl) amino) ethanamide

Sign In for Pricing
View Details
ITPR1 Rabbit Polyclonal Antibody
orb1544412-01 50 μL

ITPR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ITPR1 Rabbit Polyclonal Antibody
orb1544412-02 100 µL

ITPR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human LDB3 shRNA (UAS) - Lentiviral human LDB3 shRNA (UAS, GFP) plasmid
GTR15080650 1 Vial

Lentiviral human LDB3 shRNA (UAS) - Lentiviral human LDB3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mucin 1 (MUC1 Glycoprotein, CD227) (HRP)
M4700-11F-HRP 100 µL

Mucin 1 (MUC1 Glycoprotein, CD227) (HRP)

Sign In for Pricing
View Details
LentimiRa-mmu-miR-7655-3p Vector
mm42027 500 ng

LentimiRa-mmu-miR-7655-3p Vector

Sign In for Pricing
View Details