Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRPA1 protein

This Human TRPA1 protein spans the amino acid sequence from region 957-1119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ankyrin-like with transmembrane domains protein 1 Transformation-sensitive protein p120

UniProt

O75762

Expression Region

957-1119aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SESN1 Rabbit Monoclonal Antibody [Clone ID: R09-7H-1]
TA422179 100 µL

SESN1 Rabbit Monoclonal Antibody [Clone ID: R09-7H-1]

Sign In for Pricing
View Details
Chk2 Rabbit Monoclonal Antibody
E56G2587 100 µL

Chk2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD340/ERBB2/HER2/NEU Antibody (A21), PerCP
MBS1582637-01 50 Tests

Anti-Human CD340/ERBB2/HER2/NEU Antibody (A21), PerCP

Sign In for Pricing
View Details
Anti-Human CD340/ERBB2/HER2/NEU Antibody (A21), PerCP
MBS1582637-02 100 Tests

Anti-Human CD340/ERBB2/HER2/NEU Antibody (A21), PerCP

Sign In for Pricing
View Details
Anti-Human CD340/ERBB2/HER2/NEU Antibody (A21), PerCP
MBS1582637-03 5x 100 Tests

Anti-Human CD340/ERBB2/HER2/NEU Antibody (A21), PerCP

Sign In for Pricing
View Details
Human VPS26A siRNA
abx906037-01 15 nmol

Human VPS26A siRNA

Sign In for Pricing
View Details