Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile subunit alpha protein

This Reptile subunit alpha protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aggretin alpha chain Rhodoaggretin subunit alpha

UniProt

Q9I841

Expression Region

1-136aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Canine Coronavirus (CCoV) Nucleoprotein Monoclonal Antibody
VD7N99 1 Each

Mouse Anti-Canine Coronavirus (CCoV) Nucleoprotein Monoclonal Antibody

Sign In for Pricing
View Details
TRX1 Rabbit mAb
RDSA67225 100 µL

TRX1 Rabbit mAb

Sign In for Pricing
View Details
RPS19 Antibody, HRP conjugated
CSB-PA00655B0Rb-01 50 µg

RPS19 Antibody, HRP conjugated

Sign In for Pricing
View Details
RPS19 Antibody, HRP conjugated
CSB-PA00655B0Rb-02 100 µg

RPS19 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mucolipin 1 (MCOLN1) Human Over-expression Lysate
orb1376897 20 µg

Mucolipin 1 (MCOLN1) Human Over-expression Lysate

Sign In for Pricing
View Details
RAB13 (Ras-related Protein Rab-13, Cell Growth-inhibiting Gene 4 Protein, GIG4) (MaxLight 650)
132161-ML650 100 µL

RAB13 (Ras-related Protein Rab-13, Cell Growth-inhibiting Gene 4 Protein, GIG4) (MaxLight 650)

Sign In for Pricing
View Details