Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile subunit alpha protein

This Reptile subunit alpha protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aggretin alpha chain Rhodoaggretin subunit alpha

UniProt

Q9I841

Expression Region

1-136aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD134 (ACT35 Antigen, OX40, OX40L Receptor, TAX Transcriptionally-activated Glycoprotein 1 Receptor, TXGP1L, Tumor Necrosis Factor Receptor Superfamily Member 4, TNFRSF4)
C2515-19X 100 µg

CD134 (ACT35 Antigen, OX40, OX40L Receptor, TAX Transcriptionally-activated Glycoprotein 1 Receptor, TXGP1L, Tumor Necrosis Factor Receptor Superfamily Member 4, TNFRSF4)

Sign In for Pricing
View Details
Lentiviral human YKT6 sgRNA gene knockout kit - Lentiviral human YKT6 sgRNA gene knockout kit (100)
GTR15355410 1 Vial

Lentiviral human YKT6 sgRNA gene knockout kit - Lentiviral human YKT6 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Lentiviral mouse Polr1e shRNA (UAS) - Lentiviral mouse Polr1e shRNA (UAS, GFP) plasmid
GTR15208414 1 Vial

Lentiviral mouse Polr1e shRNA (UAS) - Lentiviral mouse Polr1e shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
OXA (17-33)
256127 1 mg

OXA (17-33)

Sign In for Pricing
View Details
Anti-SSH3BP1/ABI1 Antibody Picoband®
PA1001 100 µg/Vial

Anti-SSH3BP1/ABI1 Antibody Picoband®

Sign In for Pricing
View Details
STAU1 (Staufen, RNA Binding Protein, Homolog 1 (Drosophila), FLJ25010, STAU) (Biotin)
MBS6170564-01 0.1 mL

STAU1 (Staufen, RNA Binding Protein, Homolog 1 (Drosophila), FLJ25010, STAU) (Biotin)

Sign In for Pricing
View Details