Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile subunit alpha protein

This Reptile subunit alpha protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aggretin alpha chain Rhodoaggretin subunit alpha

UniProt

Q9I841

Expression Region

1-136aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KMT5B Rabbit Polyclonal Antibody (Biotin)
orb2134430 100 µL

KMT5B Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
RPC Rabbit Polyclonal Antibody
orb214810-01 30 µL

RPC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPC Rabbit Polyclonal Antibody
orb214810-02 50 μL

RPC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPC Rabbit Polyclonal Antibody
orb214810-03 100 µL

RPC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPC Rabbit Polyclonal Antibody
orb214810-04 200 µL

RPC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DOR agonist 3
orb3136537-01 50 mg

DOR agonist 3

Sign In for Pricing
View Details