Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial dnaK protein

This Bacterial dnaK protein spans the amino acid sequence from region 423-595aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HSP70 Heat shock 70KDA protein Heat shock protein 70

UniProt

P75344

Expression Region

423-595aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGERPMARDNKSLGRFNLGGIQPAPKGKPQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELRNEGESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKANDYTKLKAEIENFKKWREEMAKKYNPNGDQGQPAQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cntnap1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7110205 3x 1.0 µg

Cntnap1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Rat CTSL1 Protein, His (Fc)-Avi-tagged
CTSL1-1327R 50 µg

Recombinant Rat CTSL1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
General Nitrotyrosine ELISA Kit
MBS2885439-01 48 Well

General Nitrotyrosine ELISA Kit

Sign In for Pricing
View Details
General Nitrotyrosine ELISA Kit
MBS2885439-02 96 Well

General Nitrotyrosine ELISA Kit

Sign In for Pricing
View Details
General Nitrotyrosine ELISA Kit
MBS2885439-03 5x 96 Well

General Nitrotyrosine ELISA Kit

Sign In for Pricing
View Details
General Nitrotyrosine ELISA Kit
MBS2885439-04 10x 96 Well

General Nitrotyrosine ELISA Kit

Sign In for Pricing
View Details