Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial dnaK protein

This Bacterial dnaK protein spans the amino acid sequence from region 423-595aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HSP70 Heat shock 70KDA protein Heat shock protein 70

UniProt

P75344

Expression Region

423-595aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGERPMARDNKSLGRFNLGGIQPAPKGKPQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELRNEGESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKANDYTKLKAEIENFKKWREEMAKKYNPNGDQGQPAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SKA2 Antibody [DyLight 550]
NBP1-76312R 0.1 mL

Rabbit Polyclonal SKA2 Antibody [DyLight 550]

Sign In for Pricing
View Details
Pde4b (NM_001177983) Mouse Tagged ORF Clone Lentiviral Particle
MR224451L4V 200 µL

Pde4b (NM_001177983) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Hemoglobin A1C, Hba1C ELISA KIT
E1620Mo-01 48 Well

Mouse Hemoglobin A1C, Hba1C ELISA KIT

Sign In for Pricing
View Details
Mouse Hemoglobin A1C, Hba1C ELISA KIT
E1620Mo-02 96 Well

Mouse Hemoglobin A1C, Hba1C ELISA KIT

Sign In for Pricing
View Details
Mouse Hemoglobin A1C, Hba1C ELISA KIT
E1620Mo-03 5x 96 Tests

Mouse Hemoglobin A1C, Hba1C ELISA KIT

Sign In for Pricing
View Details
Mouse Hemoglobin A1C, Hba1C ELISA KIT
E1620Mo-04 10x 96 Tests

Mouse Hemoglobin A1C, Hba1C ELISA KIT

Sign In for Pricing
View Details