Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FAM150A protein

This Human FAM150A protein spans the amino acid sequence from region 28-129. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ALKAL1, FAM150A, UNQ9433/PRO34745ALK and LTK ligand 1, Augmentor beta, AUG-beta, Protein FAM150A

UniProt

Q6UXT8

Expression Region

28-129

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Macrophage and Histiocytoma Marker Antibody (D11) [PE]
NBP3-11429PE 0.1 mL

Mouse Monoclonal Macrophage and Histiocytoma Marker Antibody (D11) [PE]

Sign In for Pricing
View Details
GOLPH2 (GOLM1) Mouse Monoclonal Antibody [Clone ID: LBI4B12]
AMM12188VCF 100 µg

GOLPH2 (GOLM1) Mouse Monoclonal Antibody [Clone ID: LBI4B12]

Sign In for Pricing
View Details
Selective supplement to make GVPC for Legionella detection according to ISO 11731
TMB_GVPC_SUPP1_1 1 Each

Selective supplement to make GVPC for Legionella detection according to ISO 11731

Sign In for Pricing
View Details
Recombinant Nitrobacter hamburgensis Homoserine O-acetyltransferase (metX)
MBS1397676-01 0.02 mg (E-Coli)

Recombinant Nitrobacter hamburgensis Homoserine O-acetyltransferase (metX)

Sign In for Pricing
View Details
Recombinant Nitrobacter hamburgensis Homoserine O-acetyltransferase (metX)
MBS1397676-02 0.02 mg (Yeast)

Recombinant Nitrobacter hamburgensis Homoserine O-acetyltransferase (metX)

Sign In for Pricing
View Details
Recombinant Nitrobacter hamburgensis Homoserine O-acetyltransferase (metX)
MBS1397676-03 0.1 mg (E-Coli)

Recombinant Nitrobacter hamburgensis Homoserine O-acetyltransferase (metX)

Sign In for Pricing
View Details