Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial map protein

This Bacterial map protein spans the amino acid sequence from region 1-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, MAPUniRule annotation Short name, MetAPUniRule annotation Alternative name (s), Peptidase M

UniProt

Q11132

Expression Region

1-248aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYICDAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFECLTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNTL5 ORF Vector (Human) (pORF)
ORF004299 1.0 µg DNA

GALNTL5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Sulfolobus solfataricus Translation initiation factor 2 subunit gamma (eif2g)
MBS1449595-01 0.02 mg (E-Coli)

Recombinant Sulfolobus solfataricus Translation initiation factor 2 subunit gamma (eif2g)

Sign In for Pricing
View Details
Recombinant Sulfolobus solfataricus Translation initiation factor 2 subunit gamma (eif2g)
MBS1449595-02 0.02 mg (Yeast)

Recombinant Sulfolobus solfataricus Translation initiation factor 2 subunit gamma (eif2g)

Sign In for Pricing
View Details
Recombinant Sulfolobus solfataricus Translation initiation factor 2 subunit gamma (eif2g)
MBS1449595-03 0.1 mg (E-Coli)

Recombinant Sulfolobus solfataricus Translation initiation factor 2 subunit gamma (eif2g)

Sign In for Pricing
View Details
Recombinant Sulfolobus solfataricus Translation initiation factor 2 subunit gamma (eif2g)
MBS1449595-04 0.1 mg (Yeast)

Recombinant Sulfolobus solfataricus Translation initiation factor 2 subunit gamma (eif2g)

Sign In for Pricing
View Details
Recombinant Sulfolobus solfataricus Translation initiation factor 2 subunit gamma (eif2g)
MBS1449595-05 0.02 mg (Baculovirus)

Recombinant Sulfolobus solfataricus Translation initiation factor 2 subunit gamma (eif2g)

Sign In for Pricing
View Details