Bacterial map protein
This Bacterial map protein spans the amino acid sequence from region 1-248aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Short name, MAPUniRule annotation Short name, MetAPUniRule annotation Alternative name (s), Peptidase M
UniProt
Q11132
Expression Region
1-248aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
43.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYICDAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFECLTN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-52507R-BF405-TR 20 µL
Phospho-Tau (Thr231) Recombinant Antibody, AbBy Fluor™ 405 Conjugated
Sign In for Pricing
View Details NBP2-34571JF646 0.1 mL
Mouse Monoclonal Bcl-xL Antibody (BX006 + 2H12) [Janelia Fluor 646]
Sign In for Pricing
View Details 123124-HRP 100 µL
AK3 (GTP:AMP Phosphotransferase, Mitochondrial, Adenylate Kinase 3, AK 3, Adenylate Kinase 3 alpha-like 1, AK3L1, AK6, AKL3L) (HRP)
Sign In for Pricing
View Details 