Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial lon protein

This Bacterial lon protein spans the amino acid sequence from region 1-206aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-dependent protease La

UniProt

P78025

Expression Region

1-206aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPAVKKPQILVVRNQVIFPYNGFELDVGRERSKKLIKALKNLKTKRLVLVTQKNSDQLNPEFDDIYHCGTLCDIDEIIEVPSEDGKTADYKIKGKGLQRVAITSFSDADLTKYDHHFLNSTLTENKALDKLLERIFPDKEDFAEILDSLNSFLELQELKKLSKVPKDIKRYDIITFKLASLIFKDITLQQAILEENDIEKRLQKII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT6 Conjugated Antibody
MBS9446045-01 0.1 mL (Biotin)

STAT6 Conjugated Antibody

Sign In for Pricing
View Details
STAT6 Conjugated Antibody
MBS9446045-02 0.1 mL (AF350)

STAT6 Conjugated Antibody

Sign In for Pricing
View Details
STAT6 Conjugated Antibody
MBS9446045-03 0.1 mL (AF405)

STAT6 Conjugated Antibody

Sign In for Pricing
View Details
STAT6 Conjugated Antibody
MBS9446045-04 0.1 mL (AF488)

STAT6 Conjugated Antibody

Sign In for Pricing
View Details
STAT6 Conjugated Antibody
MBS9446045-05 0.1 mL (AF555)

STAT6 Conjugated Antibody

Sign In for Pricing
View Details
STAT6 Conjugated Antibody
MBS9446045-06 0.1 mL (AF594)

STAT6 Conjugated Antibody

Sign In for Pricing
View Details