Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral K3L protein

This Viral K3L protein spans the amino acid sequence from region 1-88aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

K3L, Protein K3

UniProt

P20639

Expression Region

1-88aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RLN3 Antibody Picoband® Fluoro594 Conjugated
A05495-2-Fluoro594 100 µg/Vial

Anti-RLN3 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
ZNF295 (ZBTB21) (NM_001098402) Human Tagged Lenti ORF Clone
RC214691L4 10 µg

ZNF295 (ZBTB21) (NM_001098402) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GNA11 Antibody, FITC conjugated
A23392-50UG 50 µg

GNA11 Antibody, FITC conjugated

Sign In for Pricing
View Details
Silver crimp cap (11mm) (Aluminium: red silicone/clear PTFE septa: 1.0mm thickness) ; Level 2 High-throughput Applications
6ACC11RT1F 5000 / PCK

Silver crimp cap (11mm) (Aluminium: red silicone/clear PTFE septa: 1.0mm thickness) ; Level 2 High-throughput Applications

Sign In for Pricing
View Details
Human WHAMM Protein Lysate
MBS8429865-01 0.02 mg

Human WHAMM Protein Lysate

Sign In for Pricing
View Details
Human WHAMM Protein Lysate
MBS8429865-02 5x 0.02 mg

Human WHAMM Protein Lysate

Sign In for Pricing
View Details