Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral K3L protein

This Viral K3L protein spans the amino acid sequence from region 1-88aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

K3L, Protein K3

UniProt

P20639

Expression Region

1-88aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF3IP3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV628193 1.0 µg DNA

TRAF3IP3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Lamin B1 Monoclonal Antibody, Biotin Conjugated
bsm-33040M-Biotin 100 µL

Lamin B1 Monoclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
2-Bromo-3-fluoro-4-methyl-1- (methylthio) benzene
PC1017036-01 250 mg

2-Bromo-3-fluoro-4-methyl-1- (methylthio) benzene

Sign In for Pricing
View Details
2-Bromo-3-fluoro-4-methyl-1- (methylthio) benzene
PC1017036-02 500 mg

2-Bromo-3-fluoro-4-methyl-1- (methylthio) benzene

Sign In for Pricing
View Details
2-Bromo-3-fluoro-4-methyl-1- (methylthio) benzene
PC1017036-03 1 g

2-Bromo-3-fluoro-4-methyl-1- (methylthio) benzene

Sign In for Pricing
View Details
Stat5b Antibody - C-terminal region : HRP (ARP37147_P050-HRP)
ARP37147_P050-HRP 100 µL

Stat5b Antibody - C-terminal region : HRP (ARP37147_P050-HRP)

Sign In for Pricing
View Details