Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog Allergen Can f 2 protein

This Dog Allergen Can f 2 protein spans the amino acid sequence from region 19-180aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Dog 2 Allergen, Can f 2

UniProt

O18874

Expression Region

19-180aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-500 1x 500 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-100 1x 100 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-100 1x 100 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-500 1x 500 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details