Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Hirudin variant-1 protein

This Animal Hirudin variant-1 protein spans the amino acid sequence from region 1-65aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hirudin variant-1, Hirudin-1, Hirudin-I, Lepirudin

UniProt

P01050

Expression Region

1-65aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Hirudo medicinalis (Medicinal leech)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Hip
CS706930 5x 5 µm

Tissue FFPE Sections, Hip

Sign In for Pricing
View Details
NOTCH3 Rabbit Polyclonal Antibody
HA500519 100 µL

NOTCH3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Isonitrosoacetophenone
TRC-I821860-1G 1 g

2-Isonitrosoacetophenone

Sign In for Pricing
View Details
Recombinant Mouse TFPI2 Protein (Fc Tag)
PKSM040393 50 µg

Recombinant Mouse TFPI2 Protein (Fc Tag)

Sign In for Pricing
View Details
GCLC Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A3]
TA507318BM 100 µL

GCLC Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A3]

Sign In for Pricing
View Details
Xanthopterin Hydrate
TRC-X742003-100MG 100 mg

Xanthopterin Hydrate

Sign In for Pricing
View Details