Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Hirudin variant-1 protein

This Animal Hirudin variant-1 protein spans the amino acid sequence from region 1-65aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hirudin variant-1, Hirudin-1, Hirudin-I, Lepirudin

UniProt

P01050

Expression Region

1-65aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Hirudo medicinalis (Medicinal leech)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASL11B (N-term) Rabbit Polyclonal Antibody
AP18175PU-N 400 µL

RASL11B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760), Biotin conjugate, 0.1mg/mL
BNCB0760-500 1x 500 µL

Cytokeratin 7 (KRT7/760), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NOS1 (1-181) Mouse Monoclonal Antibody [Clone ID: N1]
AM20651PU-N 100 µg

NOS1 (1-181) Mouse Monoclonal Antibody [Clone ID: N1]

Sign In for Pricing
View Details
TNFSF18 (NM_005092) Human Recombinant Protein
TP310901 20 µg

TNFSF18 (NM_005092) Human Recombinant Protein

Sign In for Pricing
View Details
Adenovirus E1A (E1A) Sheep Polyclonal Antibody
AP05003PU-N 100 µg

Adenovirus E1A (E1A) Sheep Polyclonal Antibody

Sign In for Pricing
View Details
CD45RA (158-4D3), CF488A conjugate, 0.1mg/mL
BNC880028-100 1x 100 µL

CD45RA (158-4D3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details