Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Streptavidin protein

This Bacterial Streptavidin protein spans the amino acid sequence from region 25-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Streptavidin

UniProt

P22629

Expression Region

25-183aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Streptomyces avidinii

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4755-3p mimic
HY-R01369-01 5 nmol

Hsa-miR-4755-3p mimic

Sign In for Pricing
View Details
Hsa-miR-4755-3p mimic
HY-R01369-02 20 nmol

Hsa-miR-4755-3p mimic

Sign In for Pricing
View Details
Rabbit Polyclonal MESDC1 Antibody
NBP2-68923-25ul 25 µL

Rabbit Polyclonal MESDC1 Antibody

Sign In for Pricing
View Details
(4- (1-Isopropyl-4- (trifluoromethyl) -1H-imidazol-2-yl) phenyl) methanamine
PC1002844-01 100 mg

(4- (1-Isopropyl-4- (trifluoromethyl) -1H-imidazol-2-yl) phenyl) methanamine

Sign In for Pricing
View Details
(4- (1-Isopropyl-4- (trifluoromethyl) -1H-imidazol-2-yl) phenyl) methanamine
PC1002844-02 250 mg

(4- (1-Isopropyl-4- (trifluoromethyl) -1H-imidazol-2-yl) phenyl) methanamine

Sign In for Pricing
View Details
(4- (1-Isopropyl-4- (trifluoromethyl) -1H-imidazol-2-yl) phenyl) methanamine
PC1002844-03 1 g

(4- (1-Isopropyl-4- (trifluoromethyl) -1H-imidazol-2-yl) phenyl) methanamine

Sign In for Pricing
View Details