What is the catalog number for Drosophila UbcD6 protein?

The catalog number for Drosophila UbcD6 protein is orb383013.

What sizes are available for Drosophila UbcD6 protein?

Drosophila UbcD6 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Drosophila UbcD6 protein come in?

Drosophila UbcD6 protein is available in 3 different pack sizes.

Is Drosophila UbcD6 protein in stock?

Drosophila UbcD6 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Drosophila UbcD6 protein

This Drosophila UbcD6 protein spans the amino acid sequence from region 1-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin carrier proteinUbiquitin-protein ligase

UniProt

P25153

Expression Region

1-151aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Cancer, DNA Damage

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID