Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ureA protein

This Bacterial ureA protein spans the amino acid sequence from region 1-238aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Urea amidohydrolase subunit alpha

UniProt

P14916

Expression Region

1-238aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology; Kidney & Urological Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Listeria innocua serovar 6a UPF0754 membrane protein lin2327 (lin2327)
orb2925536-01 20 µg

Recombinant Listeria innocua serovar 6a UPF0754 membrane protein lin2327 (lin2327)

Sign In for Pricing
View Details
Recombinant Listeria innocua serovar 6a UPF0754 membrane protein lin2327 (lin2327)
orb2925536-02 100 µg

Recombinant Listeria innocua serovar 6a UPF0754 membrane protein lin2327 (lin2327)

Sign In for Pricing
View Details
TPSG1 Rabbit Polyclonal Antibody (BF555)
orb2531969 100 µL

TPSG1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Rat Complement 3, C3 ELISA Kit
CSB-E08666r-01 48 Tests

Rat Complement 3, C3 ELISA Kit

Sign In for Pricing
View Details
Rat Complement 3, C3 ELISA Kit
CSB-E08666r-02 96 Tests

Rat Complement 3, C3 ELISA Kit

Sign In for Pricing
View Details
Rat Complement 3, C3 ELISA Kit
CSB-E08666r-03 5x 96 Tests

Rat Complement 3, C3 ELISA Kit

Sign In for Pricing
View Details