What is the catalog number for Bacterial ureA protein?

The catalog number for Bacterial ureA protein is orb383012.

What sizes are available for Bacterial ureA protein?

Bacterial ureA protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial ureA protein come in?

Bacterial ureA protein is available in 3 different pack sizes.

Is Bacterial ureA protein in stock?

Bacterial ureA protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial ureA protein

This Bacterial ureA protein spans the amino acid sequence from region 1-238aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Urea amidohydrolase subunit alpha

UniProt

P14916

Expression Region

1-238aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology; Kidney & Urological Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE