Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Toxoplasma gondii GRA1 protein

This Toxoplasma gondii GRA1 protein spans the amino acid sequence from region 25-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major antigen p24

UniProt

P13403

Expression Region

25-190aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Toxoplasma gondii

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LCE6A shRNA (UAS) - Lentiviral human LCE6A shRNA (UAS, GFP) plasmid
GTR15147814 1 Vial

Lentiviral human LCE6A shRNA (UAS) - Lentiviral human LCE6A shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Atorvastatin Calcium
C08261-01 50 mg

Atorvastatin Calcium

Sign In for Pricing
View Details
Atorvastatin Calcium
C08261-02 10 mM / 1 mL

Atorvastatin Calcium

Sign In for Pricing
View Details
Atorvastatin Calcium
C08261-03 500 mg

Atorvastatin Calcium

Sign In for Pricing
View Details
Atorvastatin Calcium
C08261-04 1 g

Atorvastatin Calcium

Sign In for Pricing
View Details
NCRNA00152 Protein Vector (Human) (pPB-N-His)
PV027826 500 ng

NCRNA00152 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details