Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TFF1 protein

This Human TFF1 protein spans the amino acid sequence from region 25-84aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Breast cancer estrogen-inducible protein, PNR-2, Polypeptide P1.A , hP1.AProtein pS2

UniProt

P04155

Expression Region

25-84aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NONO (NM_001145409) AAV Particle
RC226579A1V 250 µL

Human NONO (NM_001145409) AAV Particle

Sign In for Pricing
View Details
METAP2 ELISA Kit (Human) (OKCD02723)
OKCD02723 96 Well

METAP2 ELISA Kit (Human) (OKCD02723)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 4 Alpha trans-inducing factor 82 kDa protein (14), partial
MBS1060673 Inquire

Recombinant Equine herpesvirus 4 Alpha trans-inducing factor 82 kDa protein (14), partial

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Alpha-Hemoglobin Stabilizing Protein (aHSP)
MBS2042088-01 0.1 mL

APC-Linked Polyclonal Antibody to Alpha-Hemoglobin Stabilizing Protein (aHSP)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Alpha-Hemoglobin Stabilizing Protein (aHSP)
MBS2042088-02 0.2 mL

APC-Linked Polyclonal Antibody to Alpha-Hemoglobin Stabilizing Protein (aHSP)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Alpha-Hemoglobin Stabilizing Protein (aHSP)
MBS2042088-03 0.5 mL

APC-Linked Polyclonal Antibody to Alpha-Hemoglobin Stabilizing Protein (aHSP)

Sign In for Pricing
View Details