Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OGN protein

This Human OGN protein spans the amino acid sequence from region 21-298aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Corneal keratan sulfate proteoglycan; DKFZP586P2421; MIME_HUMAN; Mimecan; Mimecan proteoglycan; OG; OGN; OIF; Osteoglycin; Osteoinductive factor; SLRR3A

UniProt

P20774

Expression Region

21-298aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid: Tris/PBS-based buffer, 5%-50% glycerol.

Molecular Weight

33.7 kDa

Storage Conditions

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDH NALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNAT1 antibody - N-terminal region
MBS3224711-01 0.1 mL

MNAT1 antibody - N-terminal region

Sign In for Pricing
View Details
MNAT1 antibody - N-terminal region
MBS3224711-02 5x 0.1 mL

MNAT1 antibody - N-terminal region

Sign In for Pricing
View Details
Olfr1396 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
32842114 3x 1.0 µg

Olfr1396 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Chymotrypsin, Human Pancreas
C5070-01D 200 µg

Chymotrypsin, Human Pancreas

Sign In for Pricing
View Details
Entacapone sodium salt 100mg
A21888-100 100 mg

Entacapone sodium salt 100mg

Sign In for Pricing
View Details
NXNL1 Antibody - N-terminal region : FITC (ARP65360_P050-FITC)
ARP65360_P050-FITC 100 µL

NXNL1 Antibody - N-terminal region : FITC (ARP65360_P050-FITC)

Sign In for Pricing
View Details