Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OGN protein

This Human OGN protein spans the amino acid sequence from region 21-298aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Corneal keratan sulfate proteoglycan; DKFZP586P2421; MIME_HUMAN; Mimecan; Mimecan proteoglycan; OG; OGN; OIF; Osteoglycin; Osteoinductive factor; SLRR3A

UniProt

P20774

Expression Region

21-298aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid: Tris/PBS-based buffer, 5%-50% glycerol.

Molecular Weight

33.7 kDa

Storage Conditions

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDH NALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tigger transposable element-derived protein 3, TIGD3 ELISA Kit
MBS9341170-01 48 Well

Human Tigger transposable element-derived protein 3, TIGD3 ELISA Kit

Sign In for Pricing
View Details
Human Tigger transposable element-derived protein 3, TIGD3 ELISA Kit
MBS9341170-02 96 Well

Human Tigger transposable element-derived protein 3, TIGD3 ELISA Kit

Sign In for Pricing
View Details
Human Tigger transposable element-derived protein 3, TIGD3 ELISA Kit
MBS9341170-03 5x 96 Well

Human Tigger transposable element-derived protein 3, TIGD3 ELISA Kit

Sign In for Pricing
View Details
Human Tigger transposable element-derived protein 3, TIGD3 ELISA Kit
MBS9341170-04 10x 96 Well

Human Tigger transposable element-derived protein 3, TIGD3 ELISA Kit

Sign In for Pricing
View Details
ACER1 Knockout HCT116 Polyclonal Cells
ARG36009 1 Million

ACER1 Knockout HCT116 Polyclonal Cells

Sign In for Pricing
View Details
RABGAP1, NT (RABGAP1, Rab GTPase-activating protein 1, GAP and centrosome-associated protein, Rab6 GTPase-activating protein GAPCenA) (Biotin) discontinued
040786-Biotin 200 µL

RABGAP1, NT (RABGAP1, Rab GTPase-activating protein 1, GAP and centrosome-associated protein, Rab6 GTPase-activating protein GAPCenA) (Biotin) discontinued

Sign In for Pricing
View Details