Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT2A protein

This Human MT2A protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-2AMetallothionein-II , MT-II

UniProt

P02795

Expression Region

1-59aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morg1 (WDR83) (NM_001099737) Human Recombinant Protein
TP315520M 100 µg

Morg1 (WDR83) (NM_001099737) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human SCFD1 shRNA (UAS) - Lentiviral human SCFD1 shRNA (UAS, GFP) plasmid
GTR15115222 1 Vial

Lentiviral human SCFD1 shRNA (UAS) - Lentiviral human SCFD1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Azeliragon HCl
T2507L2-01 25 mg

Azeliragon HCl

Sign In for Pricing
View Details
Azeliragon HCl
T2507L2-02 50 mg

Azeliragon HCl

Sign In for Pricing
View Details
Azeliragon HCl
T2507L2-03 100 mg

Azeliragon HCl

Sign In for Pricing
View Details
Recombinant Human Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1 (PYROXD1)
MBS1306225-01 0.02 mg (E-Coli)

Recombinant Human Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1 (PYROXD1)

Sign In for Pricing
View Details