Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT2A protein

This Human MT2A protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-2AMetallothionein-II , MT-II

UniProt

P02795

Expression Region

1-59aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN6 Monoclonal Antibody
TA399547 100 µg

CLDN6 Monoclonal Antibody

Sign In for Pricing
View Details
PCDHA7 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
36133124 3x 1.0µg DNA

PCDHA7 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal SHPRH Antibody [DyLight 650]
NB100-440C 0.1 mL

Rabbit Polyclonal SHPRH Antibody [DyLight 650]

Sign In for Pricing
View Details
58K Golgi protein Rabbit Polyclonal Antibody (Biotin)
orb526163 100 µL

58K Golgi protein Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human Glutathione synthetase (GSS) Elisa Kit
EK712575 96 Well

Human Glutathione synthetase (GSS) Elisa Kit

Sign In for Pricing
View Details
HSD17B1 Polyclonal Antibody
E55A03205 100 µg

HSD17B1 Polyclonal Antibody

Sign In for Pricing
View Details