Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT1X protein

This Human MT1X protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-IX , MT-IX

UniProt

P80297

Expression Region

1-59aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Migration Inhibitory Factor (MIF) Antibody
abx018079 100 µg

Macrophage Migration Inhibitory Factor (MIF) Antibody

Sign In for Pricing
View Details
THRB (Thyroid Hormone Receptor beta, Nuclear Receptor Subfamily 1 Group A Member 2, GRTH, PRTH, THR1, ERBA2, NR1A2, THRB1, THRB2, C-ERBA-2, C-ERBA-BETA) (PE)
MBS6440608-01 0.1 mL

THRB (Thyroid Hormone Receptor beta, Nuclear Receptor Subfamily 1 Group A Member 2, GRTH, PRTH, THR1, ERBA2, NR1A2, THRB1, THRB2, C-ERBA-2, C-ERBA-BETA) (PE)

Sign In for Pricing
View Details
THRB (Thyroid Hormone Receptor beta, Nuclear Receptor Subfamily 1 Group A Member 2, GRTH, PRTH, THR1, ERBA2, NR1A2, THRB1, THRB2, C-ERBA-2, C-ERBA-BETA) (PE)
MBS6440608-02 5x 0.1 mL

THRB (Thyroid Hormone Receptor beta, Nuclear Receptor Subfamily 1 Group A Member 2, GRTH, PRTH, THR1, ERBA2, NR1A2, THRB1, THRB2, C-ERBA-2, C-ERBA-BETA) (PE)

Sign In for Pricing
View Details
SAP 130 CRISPR/Cas9 KO Plasmid (h)
sc-417132 20 µg

SAP 130 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Usp18 ORF Vector (Rat) (pORF)
49295016 1.0 µg DNA

Usp18 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Pol III RPC39 (m) : 293T Lysate
sc-127364 100 µg - 200 µL

Pol III RPC39 (m) : 293T Lysate

Sign In for Pricing
View Details