Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT1X protein

This Human MT1X protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-IX , MT-IX

UniProt

P80297

Expression Region

1-59aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1w2 (MaxLight 750)
MBS6256590-01 0.1 mL

CD1w2 (MaxLight 750)

Sign In for Pricing
View Details
CD1w2 (MaxLight 750)
MBS6256590-02 5x 0.1 mL

CD1w2 (MaxLight 750)

Sign In for Pricing
View Details
Krs-1 (87.K)
sc-130405 100 µg/mL

Krs-1 (87.K)

Sign In for Pricing
View Details
Lentiviral human HIPK1 shRNA (UAS) - Lentiviral human HIPK1 shRNA (UAS) plasmid
GTR15335086 1 Vial

Lentiviral human HIPK1 shRNA (UAS) - Lentiviral human HIPK1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
OPHN1P1 Protein Vector (Human) (pPM-C-HA)
34843021 500 ng

OPHN1P1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ADAM30 HDR Plasmid (m)
sc-427873-HDR 20 µg

ADAM30 HDR Plasmid (m)

Sign In for Pricing
View Details