Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT1X protein

This Human MT1X protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-IX , MT-IX

UniProt

P80297

Expression Region

1-59aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Nephrocystin-4 NPHP4 Antibody
A04919 100 µL

Anti-Nephrocystin-4 NPHP4 Antibody

Sign In for Pricing
View Details
Anti-Nudel NDEL1 Antibody
A02478 0.1 mg

Anti-Nudel NDEL1 Antibody

Sign In for Pricing
View Details
Recombinant Anopheles stephensi Nitric oxide synthase, partial
MBS1143166 Inquire

Recombinant Anopheles stephensi Nitric oxide synthase, partial

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Prolactin (PRL)
MBS2131607-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Prolactin (PRL)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Prolactin (PRL)
MBS2131607-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Prolactin (PRL)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Prolactin (PRL)
MBS2131607-03 0.5 mL

Cy3 Linked Monoclonal Antibody to Prolactin (PRL)

Sign In for Pricing
View Details