Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MPZ protein

This Human MPZ protein spans the amino acid sequence from region 30-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myelin peripheral protein , MPPMyelin protein zero

UniProt

P25189

Expression Region

30-156aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CLIC4 Protein
E30P62657A 50 µg

Recombinant Human CLIC4 Protein

Sign In for Pricing
View Details
ASXL1 (h) -PR
sc-72572-PR 10 µM - 20 µL

ASXL1 (h) -PR

Sign In for Pricing
View Details
Ras-GRF1 (phosphorylated Ser916) (Ras-specific Guanine Nucleotide-Releasing Factor 1, Ras-GRF1, CDC25Mm, Guanine Nucleotide-Releasing Protein, GNRP, Ras-specific Nucleotide Exchange Factor CDC25, Rasgrf1, Cdc25, Grf1) (HRP) discontinued
302696-HRP 100 µL

Ras-GRF1 (phosphorylated Ser916) (Ras-specific Guanine Nucleotide-Releasing Factor 1, Ras-GRF1, CDC25Mm, Guanine Nucleotide-Releasing Protein, GNRP, Ras-specific Nucleotide Exchange Factor CDC25, Rasgrf1, Cdc25, Grf1) (HRP) discontinued

Sign In for Pricing
View Details
FSHMD1B 3'UTR Luciferase Stable Cell Line
TU008315 1.0 mL

FSHMD1B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Putative BTB/POZ domain-containing protein L107 (MIMI_L107), partial
MBS1300363-01 0.05 mg (E-Coli)

Recombinant Acanthamoeba polyphaga mimivirus Putative BTB/POZ domain-containing protein L107 (MIMI_L107), partial

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Putative BTB/POZ domain-containing protein L107 (MIMI_L107), partial
MBS1300363-02 0.05 mg (Baculovirus)

Recombinant Acanthamoeba polyphaga mimivirus Putative BTB/POZ domain-containing protein L107 (MIMI_L107), partial

Sign In for Pricing
View Details